PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G470307_P01
Common NameLOC100502241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 858aa    MW: 94240.5 Da    PI: 4.9566
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G470307_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.6e-195197148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W++eEde++v+ v+++G++ W++Ia+ ++ gR +kqc++rw+++l
  GRMZM2G470307_P01 51 KGPWSKEEDEIIVQMVNKYGPKKWSAIAQALP-GRIGKQCRERWHNHL 97
                       79******************************.*************97 PP

2Myb_DNA-binding47.44.3e-15103145145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  GRMZM2G470307_P01 103 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 145
                        579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2741101IPR009057Homeodomain-like
PROSITE profilePS5129431.63646101IPR017930Myb domain
SuperFamilySSF466891.29E-3148144IPR009057Homeodomain-like
SMARTSM007179.6E-195099IPR001005SANT/Myb domain
CDDcd001671.45E-165397No hitNo description
PfamPF139213.8E-1854114No hitNo description
Gene3DG3DSA:1.10.10.601.4E-20102152IPR009057Homeodomain-like
PROSITE profilePS5129419.654102152IPR017930Myb domain
SMARTSM007174.4E-14102150IPR001005SANT/Myb domain
CDDcd001675.81E-11105145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MPSDKAKAPK KKGEEDPGIP PAPCEGEISH EPHRQRSLNG WQKVLNPELV KGPWSKEEDE  60
IIVQMVNKYG PKKWSAIAQA LPGRIGKQCR ERWHNHLNPA INKEAWTQEE EITLIHAHRM  120
YGNKWAELTK FLPGRTDNAI KNHWNSSVKK KVDSYISSGL LSQVPCLSLI ECPAQCDSLS  180
AMDQQNNGGT DCNDQNTSVV LSSDLQVNVD ANKKEAHDSH SSLCQGVCYP STETVGSVLP  240
DDLEMDMDEG SGNSIFADDQ TLCSTSNQEQ SMVPFVVAQE MPVSVLSSVS SAEQKRHLIS  300
DAKSLKSELW KDVCLQTLIT GDTDDPDASS RLNNPDSSKM DTNFLKEAYP LHTPNPSSVI  360
ETVYEPMALV TISPPFICSD GLSFAPENRS KPGEMSDCEA EMVTCSNNFF GNAEQSAKLA  420
SSDDRPEAFT MTESTTNCGG EQLTDAKEPV ASTAKERLSK DIETMPDKKK GEGALFYEPP  480
RFPGLDVPFI SCDLVTSADL QEFSPLGIRQ WMRSTMNVPT PLRLWGSPTH DESPDALKTA  540
AESFPCTSSI MKKRQRSLLS PTPDERIEKK SGIAKGVTDI SYMITATCSM NATNDEDIVT  600
ESAVCAKQPS LKHLDKKLEF SDINKENSDG ASEQAKDAQN TQLVDEQHSS PNVVNPNTDL  660
QDNIQPVQIL VEQSSNNLIS SDHGAKPSCK EVISSKSKPT KLLVEKSSPC INVDYEYVNL  720
LADTPGIKRG LESPSAWKSP WYIDMHMHFQ GFVSPADRTY DALGLVNRLS KHSAAAAVEA  780
CEMLASGNTT SDKENKDNTD GKELVTRKSQ IKIMAEARVL DFDESPAPAR TADKKLGSCH  840
RRSVSSPILP SPNLRSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-534115248159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-534115248159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.9740.0embryo| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G470307
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G470307_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0875060.0BT087506.1 Zea mays full-length cDNA clone ZM_BFb0098J09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310566.10.0uncharacterized protein LOC100502241
RefseqXP_008673352.10.0PREDICTED: uncharacterized protein LOC100502241 isoform X1
TrEMBLA0A096TYN70.0A0A096TYN7_MAIZE; Uncharacterized protein
STRINGGRMZM2G470307_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.22e-70myb domain protein 3r-4